SCOP 1.71: Domain d1hxpa2: 1hxp A:178-348

Lineage for d1hxpa2 (1hxp A:178-348)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (3 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)

7. Species Escherichia coli [TaxId:562] [54209] (4 PDB entries)

8. Domain d1hxpa2: 1hxp A:178-348 [37531]

Details for d1hxpa2

PDB Entry: 1hxp, 1.8 Å

PDB Description: nucleotide transferase

SCOP Domain Sequences for d1hxpa2:

Sequence; same for both SEQRES and ATOM records:

>d1hxpa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli}
eaeredrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllp
kahvlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlha
hfyppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv

Timeline for d1hxpa2:

• d1hxpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1hxpa2 appears in SCOP 1.69
  
• d1hxpa2 appears in SCOP 1.73
  
• d1hxpa2 appears in the current release, SCOPe 2.08