Lineage for d6e6la_ (6e6l A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. Protein automated matches [190295] (6 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187133] (89 PDB entries)
  8. Domain d6e6la_: 6e6l A: [375304]
    automated match to d5fazb_
    complexed with act, ret; mutant

Details for d6e6la_

PDB Entry: 6e6l (more details), 2.08 Å

PDB Description: crystal structure of the holo retinal-bound domain-swapped dimer q108k:k40l:t51f:y60a mutant of human cellular retinol binding protein ii
PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d6e6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e6la_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkfkttstfrna
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d6e6la_ are not available.

Timeline for d6e6la_: