SCOP 1.55: Domain d1guqa1: 1guq A:2-177

Lineage for d1guqa1 (1guq A:2-177)

Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
Fold d.13: HIT-like [54196] (1 superfamily)
Superfamily d.13.1: HIT-like [54197] (2 families)
Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
Protein Galactose-1-phosphate uridylyltransferase [54208] (1 species)
Species Escherichia coli [TaxId:562] [54209] (4 PDB entries)
Domain d1guqa1: 1guq A:2-177 [37522]

Details for d1guqa1

PDB Entry: 1guq (more details), 1.8 Å

PDB Description: structure of nucleotidyltransferase complexed with udp-glucose

SCOP Domain Sequences for d1guqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli}
tqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvrv
tgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpe
lsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpn

SCOP Domain Coordinates for d1guqa1:

Click to download the PDB-style file with coordinates for d1guqa1.
(The format of our PDB-style files is described here.)

Timeline for d1guqa1: