Lineage for d1emsb1 (1ems B:281-440)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30255Fold d.13: HIT-like [54196] (1 superfamily)
  4. 30256Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 30257Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 30274Protein NIT-FHIT fusion protein, C-terminal domain [54205] (1 species)
  7. 30275Species Worm (Caenorhabditis elegans) [54206] (1 PDB entry)
  8. 30277Domain d1emsb1: 1ems B:281-440 [37521]
    Other proteins in same PDB: d1emsa2, d1emsb2

Details for d1emsb1

PDB Entry: 1ems (more details), 2.8 Å

PDB Description: crystal structure of the c. elegans nitfhit protein

SCOP Domain Sequences for d1emsb1:

Sequence, based on SEQRES records: (download)

>d1emsb1 d.13.1.1 (B:281-440) NIT-FHIT fusion protein, C-terminal domain {Worm (Caenorhabditis elegans)}
rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv
prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra
gdfgdneiyqklashdkeperkprsneqmaeeavvyrnlm

Sequence, based on observed residues (ATOM records): (download)

>d1emsb1 d.13.1.1 (B:281-440) NIT-FHIT fusion protein, C-terminal domain {Worm (Caenorhabditis elegans)}
rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv
prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra
gdrsneqmaeeavvyrnlm

SCOP Domain Coordinates for d1emsb1:

Click to download the PDB-style file with coordinates for d1emsb1.
(The format of our PDB-style files is described here.)

Timeline for d1emsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emsb2