![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein NIT-FHIT fusion protein, C-terminal domain [54205] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [54206] (1 PDB entry) |
![]() | Domain d1emsa1: 1ems A:281-440 [37520] Other proteins in same PDB: d1emsa2, d1emsb2 complexed with emc, mpd, na |
PDB Entry: 1ems (more details), 2.8 Å
SCOPe Domain Sequences for d1emsa1:
Sequence, based on SEQRES records: (download)
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra gdfgdneiyqklashdkeperkprsneqmaeeavvyrnlm
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra gdfprsneqmaeeavvyrnlm
Timeline for d1emsa1: