Lineage for d1emsa1 (1ems A:281-440)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130734Fold d.13: HIT-like [54196] (1 superfamily)
  4. 130735Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 130736Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 130753Protein NIT-FHIT fusion protein, C-terminal domain [54205] (1 species)
  7. 130754Species Nematode (Caenorhabditis elegans) [TaxId:6239] [54206] (1 PDB entry)
  8. 130755Domain d1emsa1: 1ems A:281-440 [37520]
    Other proteins in same PDB: d1emsa2, d1emsb2

Details for d1emsa1

PDB Entry: 1ems (more details), 2.8 Å

PDB Description: crystal structure of the c. elegans nitfhit protein

SCOP Domain Sequences for d1emsa1:

Sequence, based on SEQRES records: (download)

>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans)}
rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv
prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra
gdfgdneiyqklashdkeperkprsneqmaeeavvyrnlm

Sequence, based on observed residues (ATOM records): (download)

>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans)}
rsdlytlhinekssetgglkfarfnipadhifystphsfvfvnlkpvtdghvlvspkrvv
prltdltdaetadlfivakkvqamlekhhnvtstticvqdgkdagqtvphvhihilprra
gdfprsneqmaeeavvyrnlm

SCOP Domain Coordinates for d1emsa1:

Click to download the PDB-style file with coordinates for d1emsa1.
(The format of our PDB-style files is described here.)

Timeline for d1emsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emsa2