Lineage for d1kpcc_ (1kpc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929793Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 2929794Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 2929806Domain d1kpcc_: 1kpc C: [37518]

Details for d1kpcc_

PDB Entry: 1kpc (more details), 2.2 Å

PDB Description: pkci-1-apo+zinc
PDB Compounds: (C:) human protein kinase c interacting protein 1 (zinc protein)

SCOPe Domain Sequences for d1kpcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpcc_ d.13.1.1 (C:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]}
dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d1kpcc_:

Click to download the PDB-style file with coordinates for d1kpcc_.
(The format of our PDB-style files is described here.)

Timeline for d1kpcc_: