Lineage for d6qk8d_ (6qk8 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333685Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [340944] (2 PDB entries)
  8. 3075113Domain d6qk8d_: 6qk8 D: [375175]
    automated match to d4dnkb_

Details for d6qk8d_

PDB Entry: 6qk8 (more details), 2.92 Å

PDB Description: crystal structure of yeast 14-3-3 protein (bmh1) from saccharomyces cerevisiae with the nha1p (yeast na+/h+ antiporter) 14-3-3 binding motif ser481
PDB Compounds: (D:) Protein BMH1

SCOPe Domain Sequences for d6qk8d_:

Sequence, based on SEQRES records: (download)

>d6qk8d_ a.118.7.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswr
ivssieqkeeskeksehqvelicsyrskieteltkisddilsvldshlipsattgeskvf
yykmkgdyhrylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvf
yyeiqnspdkachlakqafddaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d6qk8d_ a.118.7.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsredsvylaklaeqaeryeemvenmktvassgqelsveernllsvayknvigarraswr
ivssieqkvelicsyrskieteltkisddilsvldshlipsattgeskvfyykmkgdyhr
ylaefssgdarekatnasleayktaseiattelppthpirlglalnfsvfyyeiqnspdk
achlakqafddaiaesykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d6qk8d_:

Click to download the PDB-style file with coordinates for d6qk8d_.
(The format of our PDB-style files is described here.)

Timeline for d6qk8d_: