SCOPe 2.07: Domain d6ppya1: 6ppy A:2-281

Lineage for d6ppya1 (6ppy A:2-281)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.6: NeuB-like [110368] (3 proteins)
   Pfam PF03102

6. Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species)

7. Species Neisseria meningitidis [TaxId:491] [375115] (4 PDB entries)

8. Domain d6ppya1: 6ppy A:2-281 [375167]
   Other proteins in same PDB: d6ppya2
   automated match to d1xuua2
   complexed with ovy

Details for d6ppya1

PDB Entry: 6ppy, 2 Å

PDB Description: crystal structure of neunac oxime complexed with neub, an n- acetylneuraminate synthase from neisseria meningitidis

PDB Compounds: (A:) N-acetylneuraminate synthase

SCOPe Domain Sequences for d6ppya1:

Sequence; same for both SEQRES and ATOM records:

>d6ppya1 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 491]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

Timeline for d6ppya1:

• d6ppya1 is new in SCOPe 2.07-stable
  
• d6ppya1 appears in the current release, SCOPe 2.08