Lineage for d6ppya1 (6ppy A:2-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835884Family c.1.10.6: NeuB-like [110368] (3 proteins)
    Pfam PF03102
  6. 2835885Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species)
  7. 2835889Species Neisseria meningitidis [TaxId:491] [375115] (4 PDB entries)
  8. 2835892Domain d6ppya1: 6ppy A:2-281 [375167]
    Other proteins in same PDB: d6ppya2
    automated match to d1xuua2
    complexed with ovy

Details for d6ppya1

PDB Entry: 6ppy (more details), 2 Å

PDB Description: crystal structure of neunac oxime complexed with neub, an n- acetylneuraminate synthase from neisseria meningitidis
PDB Compounds: (A:) N-acetylneuraminate synthase

SCOPe Domain Sequences for d6ppya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ppya1 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 491]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d6ppya1:

Click to download the PDB-style file with coordinates for d6ppya1.
(The format of our PDB-style files is described here.)

Timeline for d6ppya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ppya2