Lineage for d6qcul1 (6qcu L:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355229Domain d6qcul1: 6qcu L:1-106 [375163]
    Other proteins in same PDB: d6qcul2
    automated match to d1dn0a1
    complexed with so4

Details for d6qcul1

PDB Entry: 6qcu (more details), 1.56 Å

PDB Description: crystal structure of a fab portion of the anti ebov 3t0331 antibody
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6qcul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qcul1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvstylawyqhqpgqaprlliyeasnratgipa
rfsgsgsgteftltisslepedvavyycqqraswpltfgggtkvei

SCOPe Domain Coordinates for d6qcul1:

Click to download the PDB-style file with coordinates for d6qcul1.
(The format of our PDB-style files is described here.)

Timeline for d6qcul1: