Lineage for d6ppwa2 (6ppw A:282-349)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427209Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2427210Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 2427211Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species)
  7. 2427217Species Neisseria meningitidis [TaxId:491] [375117] (4 PDB entries)
  8. 2427218Domain d6ppwa2: 6ppw A:282-349 [375160]
    Other proteins in same PDB: d6ppwa1
    automated match to d1xuua1
    complexed with mg, mlt

Details for d6ppwa2

PDB Entry: 6ppw (more details), 1.85 Å

PDB Description: crystal structure of neub, an n-acetylneuraminate synthase from neisseria meningitidis, in complex with magnesium and malate
PDB Compounds: (A:) N-acetylneuraminate synthase

SCOPe Domain Sequences for d6ppwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ppwa2 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 491]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d6ppwa2:

Click to download the PDB-style file with coordinates for d6ppwa2.
(The format of our PDB-style files is described here.)

Timeline for d6ppwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ppwa1