Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.6: NeuB-like [110368] (3 proteins) Pfam PF03102 |
Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species) |
Species Neisseria meningitidis [TaxId:491] [375115] (4 PDB entries) |
Domain d6ppwa1: 6ppw A:2-281 [375159] Other proteins in same PDB: d6ppwa2 automated match to d1xuua2 complexed with mg, mlt |
PDB Entry: 6ppw (more details), 1.85 Å
SCOPe Domain Sequences for d6ppwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ppwa1 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 491]} qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
Timeline for d6ppwa1: