SCOPe 2.07: Domain d6ppxa2: 6ppx A:282-349

Lineage for d6ppxa2 (6ppx A:282-349)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species)

7. Species Neisseria meningitidis [TaxId:491] [375117] (4 PDB entries)

8. Domain d6ppxa2: 6ppx A:282-349 [375156]
   Other proteins in same PDB: d6ppxa1
   automated match to d1xuua1
   complexed with mlt

Details for d6ppxa2

PDB Entry: 6ppx, 1.85 Å

PDB Description: crystal structure of metal-free neub, an n-acetylneuraminate synthase from neisseria meningitidis in complex with malate

PDB Compounds: (A:) N-acetylneuraminate synthase

SCOPe Domain Sequences for d6ppxa2:

Sequence; same for both SEQRES and ATOM records:

>d6ppxa2 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 491]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

Timeline for d6ppxa2:

• d6ppxa2 is new in SCOPe 2.07-stable
  
• d6ppxa2 appears in the current release, SCOPe 2.08