Lineage for d6prha_ (6prh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739109Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 2739110Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 2739111Family a.281.1.1: YmcA-like [158623] (1 protein)
    N-terminal and C-terminal parts correspond to PfamB PB012831 and PfamB PB007043, respectively
    automatically mapped to Pfam PF06133
  6. 2739112Protein Uncharacterized protein YmcA [158624] (2 species)
  7. 2739116Species Bacillus subtilis [TaxId:224308] [375125] (1 PDB entry)
  8. 2739117Domain d6prha_: 6prh A: [375126]
    automated match to d2piha1
    complexed with cl

Details for d6prha_

PDB Entry: 6prh (more details), 2.08 Å

PDB Description: x-ray crystal structure of bacillus subtilis rica
PDB Compounds: (A:) RicA

SCOPe Domain Sequences for d6prha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prha_ a.281.1.1 (A:) Uncharacterized protein YmcA {Bacillus subtilis [TaxId: 224308]}
mtlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlk
hyekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiits
tg

SCOPe Domain Coordinates for d6prha_:

Click to download the PDB-style file with coordinates for d6prha_.
(The format of our PDB-style files is described here.)

Timeline for d6prha_: