SCOPe 2.07: Domain d1kpaa_: 1kpa A:

Lineage for d1kpaa_ (1kpa A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)

8. Domain d1kpaa_: 1kpa A: [37512]

Details for d1kpaa_

PDB Entry: 1kpa, 2 Å

PDB Description: pkci-1-zinc

PDB Compounds: (A:) human protein kinase c interacting protein 1 (zinc protein)

SCOPe Domain Sequences for d1kpaa_:

Sequence; same for both SEQRES and ATOM records:

>d1kpaa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d1kpaa_:

• d1kpaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1kpaa_ appears in SCOPe 2.06
  
• d1kpaa_ appears in the current release, SCOPe 2.08