![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.6: NeuB-like [110368] (3 proteins) Pfam PF03102 |
![]() | Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species) |
![]() | Species Neisseria meningitidis [TaxId:491] [375115] (4 PDB entries) |
![]() | Domain d6ppza1: 6ppz A:2-281 [375116] Other proteins in same PDB: d6ppza2 automated match to d1xuua2 complexed with mn, mn9, po4 |
PDB Entry: 6ppz (more details), 2.4 Å
SCOPe Domain Sequences for d6ppza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ppza1 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 491]} qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
Timeline for d6ppza1: