Lineage for d6ppza1 (6ppz A:2-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835884Family c.1.10.6: NeuB-like [110368] (3 proteins)
    Pfam PF03102
  6. 2835885Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species)
  7. 2835889Species Neisseria meningitidis [TaxId:491] [375115] (4 PDB entries)
  8. 2835893Domain d6ppza1: 6ppz A:2-281 [375116]
    Other proteins in same PDB: d6ppza2
    automated match to d1xuua2
    complexed with mn, mn9, po4

Details for d6ppza1

PDB Entry: 6ppz (more details), 2.4 Å

PDB Description: crystal structure of neub, an n-acetylneuraminate synthase from neisseria meningitidis, in complex with manganese, inorganic phosphate, and n-acetylmannosamine (neub.mn2+.pi.mannac)
PDB Compounds: (A:) N-acetylneuraminate synthase

SCOPe Domain Sequences for d6ppza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ppza1 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 491]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d6ppza1:

Click to download the PDB-style file with coordinates for d6ppza1.
(The format of our PDB-style files is described here.)

Timeline for d6ppza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ppza2