Lineage for d1kpba_ (1kpb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176033Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2176080Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 2176081Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 2176085Domain d1kpba_: 1kpb A: [37510]

Details for d1kpba_

PDB Entry: 1kpb (more details), 2 Å

PDB Description: pkci-1-apo
PDB Compounds: (A:) human protein kinase c interacting protein 1 (zinc protein)

SCOPe Domain Sequences for d1kpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpba_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d1kpba_:

Click to download the PDB-style file with coordinates for d1kpba_.
(The format of our PDB-style files is described here.)

Timeline for d1kpba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kpbb_