Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species) |
Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries) Uniprot Q5CGA3 Q27552 |
Domain d6pffa1: 6pff A:3-179 [375091] Other proteins in same PDB: d6pffa2, d6pffb2, d6pffc2, d6pffd2, d6pffe2 automated match to d1qzfa1 complexed with mtx, ndp, og1, so4, ufp |
PDB Entry: 6pff (more details), 2.98 Å
SCOPe Domain Sequences for d6pffa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pffa1 c.71.1.1 (A:3-179) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqe
Timeline for d6pffa1: