Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.13: HIT-like [54196] (1 superfamily) |
Superfamily d.13.1: HIT-like [54197] (2 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins) |
Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) |
Domain d1kpea_: 1kpe A: [37508] |
PDB Entry: 1kpe (more details), 1.8 Å
SCOP Domain Sequences for d1kpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpea_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)} ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d1kpea_: