Lineage for d1kpea_ (1kpe A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77647Fold d.13: HIT-like [54196] (1 superfamily)
  4. 77648Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 77649Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 proteins)
  6. 77670Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species)
  7. 77671Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries)
  8. 77673Domain d1kpea_: 1kpe A: [37508]

Details for d1kpea_

PDB Entry: 1kpe (more details), 1.8 Å

PDB Description: pkci-transition state analog

SCOP Domain Sequences for d1kpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpea_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens)}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOP Domain Coordinates for d1kpea_:

Click to download the PDB-style file with coordinates for d1kpea_.
(The format of our PDB-style files is described here.)

Timeline for d1kpea_: