![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Protein kinase C inhibitor-1, PKCI-1 [54203] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54204] (6 PDB entries) |
![]() | Domain d1kpfa_: 1kpf A: [37507] complexed with amp |
PDB Entry: 1kpf (more details), 1.5 Å
SCOPe Domain Sequences for d1kpfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d1kpfa_: