Lineage for d6pfbc2 (6pfb C:193-521)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972111Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 2972112Species Cryptosporidium hominis [TaxId:237895] [100887] (16 PDB entries)
  8. 2972187Domain d6pfbc2: 6pfb C:193-521 [375058]
    Other proteins in same PDB: d6pfba1, d6pfbb1, d6pfbc1, d6pfbd1, d6pfbe1
    automated match to d1qzfa2
    complexed with mtx, ndp, og4, ufp

Details for d6pfbc2

PDB Entry: 6pfb (more details), 3.09 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, fdump and 3-(2-(4-((2-amino-4-oxo-4,7-dihydro-3h- pyrrolo[2,3-d]pyrimidin-5-yl)methyl)benzamido)phenyl)propanoic acid.
PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d6pfbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfbc2 d.117.1.1 (C:193-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d6pfbc2:

Click to download the PDB-style file with coordinates for d6pfbc2.
(The format of our PDB-style files is described here.)

Timeline for d6pfbc2: