SCOPe 2.05: Domain d2fhia_: 2fhi A:

Lineage for d2fhia_ (2fhi A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein FHIT (fragile histidine triad protein) [54201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54202] (8 PDB entries)

8. Domain d2fhia_: 2fhi A: [37505]
   complexed with ib2

Details for d2fhia_

PDB Entry: 2fhi, 2.6 Å

PDB Description: substrate analog (ib2) complex with the his 96 asn substitution of the fragile histidine triad protein, fhit

PDB Compounds: (A:) fragile histidine triad protein

SCOPe Domain Sequences for d2fhia_:

Sequence, based on SEQRES records:

>d2fhia_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvnvhvlprkagdfhrndsiyeelqkhd
kedfpaswrseeemaaeaaalrvyfq

Sequence, based on observed residues (ATOM records):

>d2fhia_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvnvhvlprkagdwrseeemaaeaaalr
vyfq

Timeline for d2fhia_:

• d2fhia_ first appeared (with stable ids) in SCOP 1.55, called d2fhi__
  
• d2fhia_ appears in SCOPe 2.04
  
• d2fhia_ appears in SCOPe 2.06
  
• d2fhia_ appears in the current release, SCOPe 2.08