Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species) |
Species Cryptosporidium hominis [TaxId:237895] [102636] (15 PDB entries) Uniprot Q5CGA3 Q27552 |
Domain d6pfba1: 6pfb A:3-178 [375048] Other proteins in same PDB: d6pfba2, d6pfbb2, d6pfbc2, d6pfbd2, d6pfbe2 automated match to d1qzfa1 complexed with mtx, ndp, og4, ufp |
PDB Entry: 6pfb (more details), 3.09 Å
SCOPe Domain Sequences for d6pfba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfba1 c.71.1.1 (A:3-178) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq
Timeline for d6pfba1: