Lineage for d3fita_ (3fit A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157131Protein FHIT (fragile histidine triad protein) [54201] (1 species)
  7. 2157132Species Human (Homo sapiens) [TaxId:9606] [54202] (8 PDB entries)
  8. 2157135Domain d3fita_: 3fit A: [37501]
    complexed with a, fru, so4

Details for d3fita_

PDB Entry: 3fit (more details), 2.4 Å

PDB Description: fhit (fragile histidine triad protein) in complex with adenosine/sulfate amp analog
PDB Compounds: (A:) fragile histidine protein

SCOPe Domain Sequences for d3fita_:

Sequence, based on SEQRES records: (download)

>d3fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
msfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfq
ttqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdfhrndsiyeelqkh
dkedfpaswrseeemaaeaaalrvyf

Sequence, based on observed residues (ATOM records): (download)

>d3fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
msfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfq
ttqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdwrseeemaaeaaal
rvyf

SCOPe Domain Coordinates for d3fita_:

Click to download the PDB-style file with coordinates for d3fita_.
(The format of our PDB-style files is described here.)

Timeline for d3fita_: