Lineage for d2fita_ (2fit A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176033Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2176034Protein FHIT (fragile histidine triad protein) [54201] (1 species)
  7. 2176035Species Human (Homo sapiens) [TaxId:9606] [54202] (8 PDB entries)
  8. 2176037Domain d2fita_: 2fit A: [37500]
    complexed with fru, so4

Details for d2fita_

PDB Entry: 2fit (more details), 1.9 Å

PDB Description: fhit (fragile histidine triad protein)
PDB Compounds: (A:) fragile histidine protein

SCOPe Domain Sequences for d2fita_:

Sequence, based on SEQRES records: (download)

>d2fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdfhrndsiyeelqkhd
kedfpaswrseeemaaeaaalrvyfq

Sequence, based on observed residues (ATOM records): (download)

>d2fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdfhfpaswrseeemaa
eaaalrvyfq

SCOPe Domain Coordinates for d2fita_:

Click to download the PDB-style file with coordinates for d2fita_.
(The format of our PDB-style files is described here.)

Timeline for d2fita_: