Lineage for d1fita_ (1fit A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157130Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2157131Protein FHIT (fragile histidine triad protein) [54201] (1 species)
  7. 2157132Species Human (Homo sapiens) [TaxId:9606] [54202] (8 PDB entries)
  8. 2157133Domain d1fita_: 1fit A: [37499]
    complexed with fru, so4

Details for d1fita_

PDB Entry: 1fit (more details), 1.85 Å

PDB Description: fhit (fragile histidine triad protein)
PDB Compounds: (A:) fragile histidine protein

SCOPe Domain Sequences for d1fita_:

Sequence, based on SEQRES records: (download)

>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdfhrndsiyeelqkhd
kedfpaswrseeemaaeaaalrvyfq

Sequence, based on observed residues (ATOM records): (download)

>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]}
sfrfgqhlikpsvvflktelsfalvnrkpvvpghvlvcplrpverfhdlrpdevadlfqt
tqrvgtvvekhfhgtsltfsmqdgpeagqtvkhvhvhvlprkagdaswrseeemaaeaaa
lrvyfq

SCOPe Domain Coordinates for d1fita_:

Click to download the PDB-style file with coordinates for d1fita_.
(The format of our PDB-style files is described here.)

Timeline for d1fita_: