Lineage for d6jr0f_ (6jr0 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310580Protein Histone H4 [47125] (7 species)
  7. 2310581Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (60 PDB entries)
  8. 3074911Domain d6jr0f_: 6jr0 F: [374973]
    Other proteins in same PDB: d6jr0c_, d6jr0d_, d6jr0g_, d6jr0h_
    automated match to d1kx5b_
    protein/DNA complex; complexed with cl, mn, mse

Details for d6jr0f_

PDB Entry: 6jr0 (more details), 2.5 Å

PDB Description: crystal structure of the human nucleosome phased with 12 selenium atoms
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d6jr0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jr0f_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d6jr0f_:

Click to download the PDB-style file with coordinates for d6jr0f_.
(The format of our PDB-style files is described here.)

Timeline for d6jr0f_:

  • d6jr0f_ is new in SCOPe 2.07-stable