SCOPe 2.08: Domain d3rhna_: 3rhn A:

Lineage for d3rhna_ (3rhn A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (10 PDB entries)

8. Domain d3rhna_: 3rhn A: [37497]
   complexed with 5gp

Details for d3rhna_

PDB Entry: 3rhn, 2.1 Å

PDB Description: histidine triad nucleotide-binding protein (hint) from rabbit complexed with gmp

PDB Compounds: (A:) histidine triad nucleotide-binding protein

SCOPe Domain Sequences for d3rhna_:

Sequence; same for both SEQRES and ATOM records:

>d3rhna_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rpggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedade
sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg

Timeline for d3rhna_:

• d3rhna_ first appeared (with stable ids) in SCOP 1.55, called d3rhn__
  
• d3rhna_ appears in SCOPe 2.07