Lineage for d6jr0c_ (6jr0 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698152Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [419763] (3 PDB entries)
  8. 2698155Domain d6jr0c_: 6jr0 C: [374967]
    Other proteins in same PDB: d6jr0b_, d6jr0d_, d6jr0f_, d6jr0h_
    automated match to d2pyoc_
    protein/DNA complex; complexed with cl, mn, mse

Details for d6jr0c_

PDB Entry: 6jr0 (more details), 2.5 Å

PDB Description: crystal structure of the human nucleosome phased with 12 selenium atoms
PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d6jr0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jr0c_ a.22.1.1 (C:) Histone H2A {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilemagnaardn
kktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d6jr0c_:

Click to download the PDB-style file with coordinates for d6jr0c_.
(The format of our PDB-style files is described here.)

Timeline for d6jr0c_: