Lineage for d6hora_ (6hor A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)
  8. Domain d6hora_: 6hor A: [374955]
    automated match to d1jwha_
    complexed with edo, gjk, so4

Details for d6hora_

PDB Entry: 6hor (more details), 1.8 Å

PDB Description: human protein kinase ck2 alpha in complex with feruloylmethane
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d6hora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hora_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvkd

SCOPe Domain Coordinates for d6hora_ are not available.

Timeline for d6hora_: