Lineage for d6hopa_ (6hop A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544571Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)
  8. 3074890Domain d6hopa_: 6hop A: [374952]
    automated match to d1jwha_
    complexed with ciy, edo, fer, gjk, so4, v55

Details for d6hopa_

PDB Entry: 6hop (more details), 1.55 Å

PDB Description: human protein kinase ck2 alpha in complex with curcumin degradation products
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d6hopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hopa_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytvvkd

SCOPe Domain Coordinates for d6hopa_:

Click to download the PDB-style file with coordinates for d6hopa_.
(The format of our PDB-style files is described here.)

Timeline for d6hopa_:

  • d6hopa_ is new in SCOPe 2.07-stable