Lineage for d4rhn__ (4rhn -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30255Fold d.13: HIT-like [54196] (1 superfamily)
  4. 30256Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 30257Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (4 protein domains)
  6. 30268Protein Histidine triad nucleotide-binding protein (HINT) [54199] (1 species)
  7. 30269Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (4 PDB entries)
  8. 30270Domain d4rhn__: 4rhn - [37495]

Details for d4rhn__

PDB Entry: 4rhn (more details), 1.9 Å

PDB Description: histidine triad nucleotide-binding protein (hint) from rabbit complexed with adenosine

SCOP Domain Sequences for d4rhn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rhn__ d.13.1.1 (-) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus)}
rpggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedade
sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg

SCOP Domain Coordinates for d4rhn__:

Click to download the PDB-style file with coordinates for d4rhn__.
(The format of our PDB-style files is described here.)

Timeline for d4rhn__: