Lineage for d1ffki_ (1ffk I:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253778Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 253779Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 253791Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 253792Protein Ribosomal protein L15e [54194] (1 species)
  7. 253793Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (8 PDB entries)
  8. 253797Domain d1ffki_: 1ffk I: [37494]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffki_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffki_ d.12.1.2 (I:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
mksmyayireawkrpyegyvgelmwhrlqkwrrepavvriprptrldraralgykakkgi
ivvrvrirrggrratrpnkgrkskkmmvnrrprkknlqwiaeeranrkypnmevlnsywv
gedgrykwfevilvdrdhpaiksdpqlswvsrtrgrvyrgltsagrkarglrrkgrgaek
vrpslranfrkkrr

SCOP Domain Coordinates for d1ffki_:

Click to download the PDB-style file with coordinates for d1ffki_.
(The format of our PDB-style files is described here.)

Timeline for d1ffki_: