Lineage for d1ffki_ (1ffk I:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30245Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
  4. 30246Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 30251Family d.12.1.2: L15e [54193] (1 protein)
  6. 30252Protein Ribosomal protein L15e [54194] (1 species)
  7. 30253Species Haloarcula marismortui [TaxId:2238] [54195] (1 PDB entry)
  8. 30254Domain d1ffki_: 1ffk I: [37494]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffki_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffki_ d.12.1.2 (I:) Ribosomal protein L15e {Haloarcula marismortui}
mksmyayireawkrpyegyvgelmwhrlqkwrrepavvriprptrldraralgykakkgi
ivvrvrirrggrratrpnkgrkskkmmvnrrprkknlqwiaeeranrkypnmevlnsywv
gedgrykwfevilvdrdhpaiksdpqlswvsrtrgrvyrgltsagrkarglrrkgrgaek
vrpslranfrkkrr

SCOP Domain Coordinates for d1ffki_:

Click to download the PDB-style file with coordinates for d1ffki_.
(The format of our PDB-style files is described here.)

Timeline for d1ffki_: