Lineage for d1ffkp_ (1ffk P:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407471Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 407472Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 407473Family d.12.1.1: L23p [54190] (1 protein)
  6. 407474Protein Ribosomal protein L23 [54191] (2 species)
  7. 407475Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (18 PDB entries)
  8. 407479Domain d1ffkp_: 1ffk P: [37493]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkp_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkp_ d.12.1.1 (P:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

SCOP Domain Coordinates for d1ffkp_:

Click to download the PDB-style file with coordinates for d1ffkp_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkp_: