SCOP 1.63: Domain d1ffkp_: 1ffk P:

Lineage for d1ffkp_ (1ffk P:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (8 PDB entries)

8. Domain d1ffkp_: 1ffk P: [37493]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
   complexed with cd, k, mo3; mutant

Details for d1ffkp_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkp_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkp_ d.12.1.1 (P:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Timeline for d1ffkp_:

• d1ffkp_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkp_ appears in SCOP 1.61
  
• d1ffkp_ appears in SCOP 1.65
  
• d1ffkp_ appears in the current release, SCOPe 2.08