Lineage for d1pmd_2 (1pmd 693-750)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407446Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 407447Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 407448Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 407449Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 407450Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries)
  8. 407470Domain d1pmd_2: 1pmd 693-750 [37492]
    Other proteins in same PDB: d1pmd_3, d1pmd_4
    CA-atoms only

Details for d1pmd_2

PDB Entry: 1pmd (more details), 3.5 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)

SCOP Domain Sequences for d1pmd_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmd_2 d.11.1.1 (693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd

SCOP Domain Coordinates for d1pmd_2:

Click to download the PDB-style file with coordinates for d1pmd_2.
(The format of our PDB-style files is described here.)

Timeline for d1pmd_2: