| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) ![]() duplication: consists of 2 subdomains of this fold |
| Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
| Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
| Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries) |
| Domain d1pmd_2: 1pmd 693-750 [37492] Other proteins in same PDB: d1pmd_3, d1pmd_4 CA-atoms only |
PDB Entry: 1pmd (more details), 3.5 Å
SCOP Domain Sequences for d1pmd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmd_2 d.11.1.1 (693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
Timeline for d1pmd_2: