SCOPe 2.08: Domain d6s50b1: 6s50 B:15-136

Lineage for d6s50b1 (6s50 B:15-136)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d6s50b1: 6s50 B:15-136 [374910]
   Other proteins in same PDB: d6s50a3, d6s50b3
   automated match to d2bc3a2
   complexed with 4ir, gol, so4

Details for d6s50b1

PDB Entry: 6s50, 2 Å

PDB Description: scdsav(sark)mv2 - engineering single-chain dimeric streptavidin as host for artificial metalloenzymes

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d6s50b1:

Sequence; same for both SEQRES and ATOM records:

>d6s50b1 b.61.1.1 (B:15-136) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastlvghdtftkvk
ps

Timeline for d6s50b1:

• d6s50b1 first appeared in SCOPe 2.07