Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoB [142243] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142244] (3 PDB entries) Uniprot P62745 4-185 |
Domain d6sgea_: 6sge A: [374903] Other proteins in same PDB: d6sgeb1, d6sgeb2, d6sged1, d6sged2, d6sged3 automated match to d4f38a_ complexed with gtp, mg |
PDB Entry: 6sge (more details), 1.5 Å
SCOPe Domain Sequences for d6sgea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sgea_ c.37.1.8 (A:) RhoB {Human (Homo sapiens) [TaxId: 9606]} airkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdtag ledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlr sdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalq
Timeline for d6sgea_: