SCOPe 2.08: Domain d6sgea_: 6sge A:

Lineage for d6sgea_ (6sge A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoB [142243] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142244] (3 PDB entries)
   Uniprot P62745 4-185

8. Domain d6sgea_: 6sge A: [374903]
   Other proteins in same PDB: d6sgeb1, d6sgeb2, d6sged1, d6sged2, d6sged3
   automated match to d4f38a_
   complexed with gtp, mg

Details for d6sgea_

PDB Entry: 6sge, 1.5 Å

PDB Description: crystal structure of human rhob-gtp in complex with nanobody b6

PDB Compounds: (A:) Rho-related GTP-binding protein RhoB

SCOPe Domain Sequences for d6sgea_:

Sequence; same for both SEQRES and ATOM records:

>d6sgea_ c.37.1.8 (A:) RhoB {Human (Homo sapiens) [TaxId: 9606]}
airkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdtag
ledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlr
sdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalq

Timeline for d6sgea_:

• d6sgea_ first appeared in SCOPe 2.07