Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6sgeb1: 6sge B:2-126 [374885] Other proteins in same PDB: d6sgea_, d6sgeb2, d6sgec_, d6sged2, d6sged3 automated match to d4nbzb_ complexed with gtp, mg |
PDB Entry: 6sge (more details), 1.5 Å
SCOPe Domain Sequences for d6sgeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sgeb1 b.1.1.0 (B:2-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlqasgggfvqpggslrlscaasgygstietmgwfrqapgkerefvsaisrapgpsqyy adsvkgrftisrdnskntvylqmnslraedtatyycapinnrtmqdsmflwnywgqgtqv tvssa
Timeline for d6sgeb1: