Lineage for d6sgeb1 (6sge B:2-126)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365771Domain d6sgeb1: 6sge B:2-126 [374885]
    Other proteins in same PDB: d6sgea_, d6sgeb2, d6sgec_, d6sged2, d6sged3
    automated match to d4nbzb_
    complexed with gtp, mg

Details for d6sgeb1

PDB Entry: 6sge (more details), 1.5 Å

PDB Description: crystal structure of human rhob-gtp in complex with nanobody b6
PDB Compounds: (B:) Nanobody B6

SCOPe Domain Sequences for d6sgeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sgeb1 b.1.1.0 (B:2-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlqasgggfvqpggslrlscaasgygstietmgwfrqapgkerefvsaisrapgpsqyy
adsvkgrftisrdnskntvylqmnslraedtatyycapinnrtmqdsmflwnywgqgtqv
tvssa

SCOPe Domain Coordinates for d6sgeb1:

Click to download the PDB-style file with coordinates for d6sgeb1.
(The format of our PDB-style files is described here.)

Timeline for d6sgeb1: