Lineage for d1qmea1 (1qme A:632-692)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156918Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2156919Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2156920Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2156921Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2156922Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2156923Domain d1qmea1: 1qme A:632-692 [37487]
    Other proteins in same PDB: d1qmea3, d1qmea4
    complexed with so4

Details for d1qmea1

PDB Entry: 1qme (more details), 2.4 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1qmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmea1 d.11.1.1 (A:632-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
qqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsd
k

SCOPe Domain Coordinates for d1qmea1:

Click to download the PDB-style file with coordinates for d1qmea1.
(The format of our PDB-style files is described here.)

Timeline for d1qmea1: