Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species [ruminococcus] gnavus [TaxId:411470] [374764] (2 PDB entries) |
Domain d6rb7f_: 6rb7 F: [374857] automated match to d1f74a_ complexed with bcn, gol, mg, peg, trs; mutant |
PDB Entry: 6rb7 (more details), 1.6 Å
SCOPe Domain Sequences for d6rb7f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rb7f_ c.1.10.0 (F:) automated matches {[ruminococcus] gnavus [TaxId: 411470]} mrnlekykgvipafyacydkegnispegvqgltkyfvkkgvkgvyvngssgeciyqsved rkivlenvmkvaegkltviahvacnntkdsqelarhaeglgvdaiaaippiyfhlpeyai aqywnaisaaapntdfviynipqlagvaltqnlfvemrknpnvigvanssmpvqdiqmfk qaagaeyiifngpdeqfmsgrvigaegaiggtygampelylkldecinagkmtearkiqy acneiiykmcsahgnmyavikailkineglelgavreplpalvdedmeivkeaaqmicda kkkfl
Timeline for d6rb7f_: