Lineage for d6s4qa1 (6s4q A:15-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806391Domain d6s4qa1: 6s4q A:15-134 [374851]
    Other proteins in same PDB: d6s4qa3, d6s4qb3
    automated match to d2bc3a2
    complexed with 4ir, gol

Details for d6s4qa1

PDB Entry: 6s4q (more details), 1.85 Å

PDB Description: scdsav(sask) - engineering single-chain dimeric streptavidin as host for artificial metalloenzymes
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6s4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s4qa1 b.61.1.1 (A:15-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawastlvghdtftkvk

SCOPe Domain Coordinates for d6s4qa1:

Click to download the PDB-style file with coordinates for d6s4qa1.
(The format of our PDB-style files is described here.)

Timeline for d6s4qa1: