Lineage for d1qk9a_ (1qk9 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016572Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 1016573Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 1016587Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)
  6. 1016588Protein Methyl-CpG-binding protein 2, MECP2 [54179] (2 species)
  7. 1016591Species Human (Homo sapiens) [TaxId:9606] [54180] (1 PDB entry)
  8. 1016592Domain d1qk9a_: 1qk9 A: [37485]

Details for d1qk9a_

PDB Entry: 1qk9 (more details)

PDB Description: the solution structure of the domain from mecp2 that binds to methylated dna
PDB Compounds: (A:) methyl-cpg-binding protein 2

SCOPe Domain Sequences for d1qk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens) [TaxId: 9606]}
asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
eliayfekvgdtsldpndfdftvtgrgsgsgc

SCOPe Domain Coordinates for d1qk9a_:

Click to download the PDB-style file with coordinates for d1qk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qk9a_: