Lineage for d1qk9a_ (1qk9 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130678Fold d.10: DNA-binding domain [54170] (1 superfamily)
  4. 130679Superfamily d.10.1: DNA-binding domain [54171] (3 families) (S)
  5. 130693Family d.10.1.3: Methyl-CpG-binding domain, MBD [54178] (2 proteins)
  6. 130694Protein Methyl-CpG-binding protein 2, MECP2 [54179] (1 species)
  7. 130695Species Human (Homo sapiens) [TaxId:9606] [54180] (1 PDB entry)
  8. 130696Domain d1qk9a_: 1qk9 A: [37485]

Details for d1qk9a_

PDB Entry: 1qk9 (more details)

PDB Description: the solution structure of the domain from mecp2 that binds to methylated dna

SCOP Domain Sequences for d1qk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk9a_ d.10.1.3 (A:) Methyl-CpG-binding protein 2, MECP2 {Human (Homo sapiens)}
asaspkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskv
eliayfekvgdtsldpndfdftvtgrgsgsgc

SCOP Domain Coordinates for d1qk9a_:

Click to download the PDB-style file with coordinates for d1qk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qk9a_: