Lineage for d2gcc__ (2gcc -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77601Fold d.10: DNA-binding domain [54170] (1 superfamily)
  4. 77602Superfamily d.10.1: DNA-binding domain [54171] (3 families) (S)
  5. 77610Family d.10.1.2: GCC-box binding domain [54175] (1 protein)
  6. 77611Protein GCC-box binding domain [54176] (1 species)
  7. 77612Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)
  8. 77615Domain d2gcc__: 2gcc - [37484]

Details for d2gcc__

PDB Entry: 2gcc (more details)

PDB Description: solution structure of the gcc-box binding domain, nmr, minimized mean structure

SCOP Domain Sequences for d2gcc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcc__ d.10.1.2 (-) GCC-box binding domain {Mouse-ear cress (Arabidopsis thaliana)}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

SCOP Domain Coordinates for d2gcc__:

Click to download the PDB-style file with coordinates for d2gcc__.
(The format of our PDB-style files is described here.)

Timeline for d2gcc__: