Lineage for d2gcca_ (2gcc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929442Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 2929443Superfamily d.10.1: DNA-binding domain [54171] (5 families) (S)
  5. 2929451Family d.10.1.2: GCC-box binding domain [54175] (1 protein)
  6. 2929452Protein GCC-box binding domain [54176] (1 species)
  7. 2929453Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [54177] (3 PDB entries)
  8. 2929455Domain d2gcca_: 2gcc A: [37484]

Details for d2gcca_

PDB Entry: 2gcc (more details)

PDB Description: solution structure of the gcc-box binding domain, nmr, minimized mean structure
PDB Compounds: (A:) aterf1

SCOPe Domain Sequences for d2gcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcca_ d.10.1.2 (A:) GCC-box binding domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv

SCOPe Domain Coordinates for d2gcca_:

Click to download the PDB-style file with coordinates for d2gcca_.
(The format of our PDB-style files is described here.)

Timeline for d2gcca_: