Lineage for d6sevb_ (6sev B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701933Species Listeria innocua [TaxId:1642] [47252] (7 PDB entries)
  8. 2701948Domain d6sevb_: 6sev B: [374836]
    automated match to d1qgha_
    complexed with zn

Details for d6sevb_

PDB Entry: 6sev (more details), 2 Å

PDB Description: structure of dps from listeria innocua soaked with 10 mm zinc for 120 minutes
PDB Compounds: (B:) DNA starvation/stationary phase protection protein

SCOPe Domain Sequences for d6sevb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sevb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d6sevb_:

Click to download the PDB-style file with coordinates for d6sevb_.
(The format of our PDB-style files is described here.)

Timeline for d6sevb_: