Lineage for d6sgec_ (6sge C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867850Protein RhoB [142243] (1 species)
  7. 2867851Species Human (Homo sapiens) [TaxId:9606] [142244] (3 PDB entries)
    Uniprot P62745 4-185
  8. 2867854Domain d6sgec_: 6sge C: [374833]
    Other proteins in same PDB: d6sgeb1, d6sgeb2, d6sged1, d6sged2, d6sged3
    automated match to d4f38a_
    complexed with gtp, mg

Details for d6sgec_

PDB Entry: 6sge (more details), 1.5 Å

PDB Description: crystal structure of human rhob-gtp in complex with nanobody b6
PDB Compounds: (C:) Rho-related GTP-binding protein RhoB

SCOPe Domain Sequences for d6sgec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sgec_ c.37.1.8 (C:) RhoB {Human (Homo sapiens) [TaxId: 9606]}
aairkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdta
gledydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdl
rsdehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqk
ry

SCOPe Domain Coordinates for d6sgec_:

Click to download the PDB-style file with coordinates for d6sgec_.
(The format of our PDB-style files is described here.)

Timeline for d6sgec_: